IGF-1 DES – 1mg

$46.99

  • Core Purpose: Research peptide, a truncated variant of IGF-1, used to investigate potent local anabolic effects.
  • Main Benefits: Supports studies on muscle hypertrophy, tissue repair, and cellular regeneration.
  • Key Features: White lyophilized powder, 1mg mass, supplied in a 1mg vial, features a unique amino acid sequence for enhanced receptor binding.
Category:
Description

Buy IGF-1 DES Peptide

IGF-1 DES For Sale : An Advanced Peptide for Targeted Growth and Repair Research

Welcome to Researchem, your trusted source for high-quality research peptides. We’re proud to offer IGF-1 DES for sale, a powerful and highly sought-after variant of Insulin-like Growth Factor-1.

IGF-1 DES, scientifically known as Insulin-like growth factor 1, des-(1-3)-, is distinct from native IGF-1. It lacks the first three amino acids from its N-terminus. This unique structural modification grants it enhanced potency and a more focused action for localized research.

Researchers worldwide recognize IGF-1 DES as an invaluable tool. It allows for the exploration of cellular proliferation, differentiation, and tissue repair mechanisms. Its primary research interest lies in its capacity to stimulate localized anabolic processes.

This comprehensive product description provides an in-depth understanding of IGF-1 DES. It covers its unique properties, potential research applications, and why it is a premier choice for your critical laboratory investigations.

When you buy IGF 1 DES Peptide from Researchem, you are investing in a meticulously characterized compound, poised to advance your studies into tissue regeneration and cellular growth.


Understanding IGF-1 DES: Targeted Anabolic Research

IGF-1 DES for sale is a fascinating peptide primarily known for its potent localized effects on various tissues, most notably muscle. Its unique structure is key to its enhanced activity compared to full-length IGF-1.

By having the first three amino acids removed, IGF-1 DES gains a significantly higher binding affinity to the IGF-1 receptor (IGF-1R). Furthermore, this modification renders it largely unaffected by IGF-binding proteins (IGFBPs). IGFBPs typically sequester native IGF-1, limiting its bioavailability and localized action. The absence of these first three amino acids means more free IGF-1 DES is available to bind directly to its receptors at the site of administration. This results in a more pronounced and targeted biological response.

The primary research focus of IGF-1 DES revolves around its powerful localized anabolic and regenerative effects. These include:

  • Muscle Growth and Hypertrophy: IGF-1 DES is highly investigated for its role in stimulating muscle cell proliferation, differentiation, and protein synthesis. Research explores its potential to promote muscle growth and recovery, making it relevant for studies on sarcopenia, muscle wasting conditions, and athletic performance enhancement.
  • Localized Tissue Repair and Regeneration: Due to its enhanced local activity, IGF-1 DES is a compelling subject for research into targeted repair and regeneration of various tissues. This includes tendons, ligaments, cartilage, and even nerve tissue, particularly in localized injury models.
  • Cellular Anabolism Studies: Beyond muscle, IGF-1 DES serves as a tool to understand general cellular anabolic pathways. Researchers can investigate its effects on protein synthesis, nutrient uptake, and cell growth in various cell lines and tissue cultures.

The focused action of IGF-1 DES makes it an indispensable tool for researchers aiming to isolate and study the direct, localized effects of the IGF-1 pathway in specific tissues, unhindered by systemic binding proteins. This precision is invaluable for advanced regenerative medicine and sports science research.


Physical Characteristics and Verified Quality: Buy IGF-1 DES with Confidence

Our premium IGF-1 DES for sale is meticulously produced and rigorously tested to ensure the highest standards of quality and consistency. We understand that the integrity and reproducibility of your research findings rely entirely on the purity and reliability of your materials.

When you buy IGF-1 DES from Researchem, you are guaranteed a product of exceptional quality. This is essential for achieving accurate and reproducible results in your sensitive experiments.

Here’s a detailed look at the precise specifications of our IGF-1 DES, ensuring transparency and reliability for your critical investigations:

Property Detail
Physical Form White lyophilized powder
Vial Size 1mg
Mass 1mg
Synonyms Insulin-like growth factor 1, des-(1-3)-, IGF-1 DES
Amino Acid Sequence TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA
CAS Number 112603-35-7
PubChem ID IGF-1 DES

The provision of the precise Amino Acid Sequence, CAS Number, and PubChem ID allows researchers to confidently identify and cross-reference this compound for their studies. This level of detail confirms the authenticity and precise characteristics of the product. Our commitment to providing this comprehensive data ensures you can conduct your experiments with unwavering confidence in your materials and the consistency of your results.


Key Research Applications and Potential Benefits of IGF-1 DES for Sale

The highly targeted and potent nature of IGF-1 DES for sale makes it an invaluable asset for a wide array of research applications, primarily focused on localized growth and repair. Its potential benefits for scientific inquiry are substantial:

  • Muscle Hypertrophy and Growth Research: This is a key area. Researchers utilize IGF-1 DES to investigate mechanisms of muscle cell proliferation, differentiation, and protein synthesis, leading to increased muscle mass. This is crucial for studies on:
    • Sarcopenia (age-related muscle loss)
    • Muscle wasting diseases
    • Post-injury muscle regeneration
    • Optimizing muscle recovery processes.
  • Localized Tissue Repair and Regeneration: Due to its enhanced local activity, IGF-1 DES is a compelling subject for research into targeted repair and regeneration of various tissues. This includes research into:
    • Tendon repair
    • Ligament healing
    • Cartilage regeneration
    • Improving recovery after orthopedic injuries.
  • Cellular Anabolism Studies: Beyond muscle, IGF-1 DES serves as a tool to understand general cellular anabolic pathways. Researchers can investigate its effects on protein synthesis, nutrient uptake, and cell growth in various cell lines and tissue cultures.

The focused action of IGF-1 DES makes it an indispensable tool for researchers aiming to isolate and study the direct, localized effects of the IGF-1 pathway in specific tissues, unhindered by systemic binding proteins. This precision is invaluable for advanced regenerative medicine and sports science research.


Recommended Laboratory Use and Administration Guidelines for Buying IGF 1 DES Peptide

As a powerful research chemical, the precise dosages and administration methods for IGF 1 DES Peptide are entirely dependent on the specific experimental design. They also rely on the research model being employed (e.g., in vitro cell cultures, in vivo animal models), and the particular scientific objectives of the study.

It is paramount that researchers approach the use of IGF-1 DES with rigorous methodology, careful planning, and strict adherence to ethical guidelines.

Here are general guidelines drawn from existing scientific literature for typical peptide research applications. Please note these are illustrative and not prescriptive recommendations for direct use:

  • Consult Peer-Reviewed Literature: Before initiating any study, it is absolutely crucial for researchers to extensively review existing peer-reviewed scientific publications relevant to IGF-1 DES (Insulin-like growth factor 1, des-(1-3)-). This provides invaluable insights into previously tested dosages, administration routes, observed effects, and safety considerations in related experimental contexts. This serves as the foundational step for designing new, robust experiments. It also helps in understanding expected outcomes.
  • In Vitro (Cell Culture) Studies: For cell culture experiments, IGF-1 DES is typically dissolved in an appropriate sterile solvent (e.g., sterile distilled water, saline, or cell culture medium) to create a stock solution. This solution is then added directly to cell cultures. Concentrations can vary significantly based on the specific cell type (e.g., muscle cells, fibroblasts), the desired cellular response (e.g., proliferation, differentiation, protein synthesis), and the duration of incubation. Common concentrations for peptides in cell culture research can be in the nanomolar (nM) to micromolar (µM) range. Researchers commonly perform dose-response curves to determine the optimal concentration for their specific experimental setup.
  • In Vivo (Animal Model) Studies: For studies involving animal models (such as rodents), IGF-1 DES is often administered via injection for targeted or systemic effects. Common routes include:
    • Intramuscular (IM) injection: This is a very common route for IGF-1 DES due to its potent localized anabolic effects on muscle tissue. Doses might range from 50 µg to 100 µg per injection site, per day, or every other day, depending on the study’s duration and goals.
    • Subcutaneous (SC) injection: For systemic absorption and broader effects, although its primary benefit is localized. Doses could be in the range of 20-50 µg/kg of body weight, per day.
    • Intraperitoneal (IP) injection: Also for systemic effects, commonly used in broader animal studies. Dosages in in vivo studies are highly experimental and typically expressed in micrograms (µg) per injection or micrograms per kilogram of body weight (µg/kg). Due to the potency of IGF-1 DES, researchers must carefully titrate initial doses and diligently monitor animal welfare throughout the experiment, as optimal dosages can be highly context-dependent.
  • Preparation and Storage: IGF-1 DES is supplied by Researchem as a white lyophilized powder. Before use, it must be reconstituted with an appropriate sterile solvent (e.g., sterile distilled water or bacteriostatic water for injections) to achieve the desired stock concentration. Proper storage conditions (typically refrigerated or frozen, as specified by the manufacturer) are absolutely critical. They maintain the peptide’s stability, potency, and purity over extended periods, ensuring reliable experimental results.
  • Ethical Considerations: All research involving IGF-1 DES must strictly adhere to the highest institutional guidelines, local regulations, and universally recognized ethical standards. This applies to research involving cells, tissues, and live animal models. This includes obtaining all necessary regulatory approvals and permits prior to commencing any study. It also ensures proper handling, administration, and disposal of all research materials.

Important Note for Researchers: The information provided here is for general guidance. It’s based on common peptide research practices and existing literature on similar compounds. It is not intended to be prescriptive medical advice or a definitive dosage regimen for IGF-1 DES. Individual experimental conditions will always necessitate careful planning, rigorous pilot studies, and precise titration. This determines the most effective and safe parameters for your specific research objectives. Our product is strictly for laboratory research use only and is not for human consumption.


Why Choose Researchem for Your IGF-1 DES Needs?

When you select IGF-1 DES for sale from Researchem, you are choosing a partner deeply committed to advancing scientific discovery. We provide uncompromised quality.

We fully understand that the integrity and reproducibility of your research findings hinge entirely on the purity and reliability of the materials you use. Our unwavering dedication ensures you receive products that consistently meet the highest possible standards.

  • Uncompromising Purity and Quality Assurance: Our IGF-1 DES undergoes stringent testing protocols. We guarantee the product you receive is synthesized with precision and purity suitable for your demanding research applications. This consistency is vital for accurate and reproducible experimental data.
  • Reliable and Ethical Sourcing: We adhere to the most rigorous quality control measures throughout our entire supply chain. Our peptides are sourced exclusively from reputable manufacturers who consistently meet our exacting standards for production. This ensures unparalleled consistency and integrity in every single vial. This comprehensive commitment extends to all ethical sourcing practices, providing you with complete peace of mind for your research.
  • Dedicated Expert Support: Our team at Researchem possesses extensive knowledge about our comprehensive product offerings. This includes the nuanced applications and handling protocols for peptides such as IGF-1 DES. We are readily available to assist with any inquiries you may have regarding product specifications, proper reconstitution methods, or general research considerations. Your success and the accuracy of your research are our highest priority.
  • Commitment to Scientific Advancement: Researchem is far more than just a supplier; we consider ourselves a dedicated and active ally to the global scientific community. By providing essential, high-quality research tools like IGF 1 DES Peptide, we actively support and facilitate groundbreaking research across a diverse range of scientific fields. This contributes directly to discoveries that have the potential to profoundly transform our understanding of tissue repair, muscle regeneration, and cellular anabolism.

Important Terms of Sale and Responsible Research Practices

At Researchem, we emphatically uphold the highest standards of responsible research and ethical conduct. It is absolutely crucial that all purchasers fully understand, thoroughly review, and explicitly accept our comprehensive Terms & Conditions prior to placing any order with us.

Terms: This material is sold exclusively for laboratory research use only. All terms of sale apply strictly. It is categorically not for human consumption, nor is it intended for any medical, veterinary, diagnostic, or household applications whatsoever. We strongly urge all customers to familiarize themselves thoroughly with our complete and detailed Terms & Conditions document prior to finalizing any purchase.

Furthermore, we explicitly advise all researchers to actively understand, diligently comply with, and strictly adhere to all applicable local laws, national regulations, and universally established ethical guidelines. This applies to the safe, legal, and responsible use of research chemicals within their respective jurisdictions. The information provided within this product description is intended solely for educational and informational purposes. Under no circumstances should it be construed as medical advice, a direct recommendation for human use, or a prescriptive guide for clinical application in any context.


Optimizing Your Research with Premium Peptides from Researchem

The relentless pursuit of scientific knowledge is a dynamic, complex, and ever-evolving journey. Having consistent access to high-quality, unequivocally reliable research materials forms the fundamental backbone of successful, impactful, and reproducible scientific endeavors. IGF-1 DES for sale at Researchem represents an essential and exceptionally powerful tool for researchers dedicated to unraveling the intricate complexities of cellular growth, tissue repair, and muscle regeneration.

By consistently providing meticulously detailed product information, guaranteeing the highest standards of product purity, and vigorously promoting responsible and ethical research practices, we empower scientists to conduct their critical studies with unwavering confidence, unparalleled precision, and maximal efficiency. We cordially invite you to explore our full range of cutting-edge research peptides by visiting our dedicated Peptides product category page to discover other advanced compounds that can significantly complement and profoundly elevate your ongoing research endeavors. For comprehensive and verified chemical information and detailed data on IGF-1 DES, you may also consult the PubChem database, a highly respected and authoritative external resource: https://pubchem.ncbi.nlm.nih.gov/compound/IGF-1-DES.


Frequently Asked Questions About Buying IGF-1 DES Peptide

What is IGF-1 DES primarily used for in research?

IGF-1 DES is primarily utilized in laboratory research to investigate potent localized anabolic effects, particularly in studies related to muscle growth, tissue repair, and cellular regeneration.

How is IGF-1 DES supplied by Researchem?

Our IGF-1 DES is supplied as a high-purity white lyophilized powder, precisely measured at a mass of 1mg, and contained within a convenient 1mg vial.

Is IGF-1 DES safe for human consumption or clinical use?

No, IGF-1 DES sold by Researchem is strictly for **laboratory research use only**. It is explicitly not intended for human consumption, nor is it for medical, veterinary, diagnostic, or any household applications. All researchers must strictly adhere to our terms of sale and responsible research guidelines.

What makes IGF-1 DES different from standard IGF-1?

IGF-1 DES is a truncated variant of IGF-1, lacking the first three amino acids. This modification gives it a higher binding affinity to the IGF-1 receptor and reduces its interaction with IGF-binding proteins, leading to more potent and localized effects in research.

Where can I find more information on peptides for research?

For a comprehensive overview of various peptides and their diverse research applications, please visit our main [Peptides product category page](https://researchemm.com/product-category/peptides/). Additionally, for comprehensive and verified chemical information and detailed data on IGF-1 DES, PubChem is an excellent external resource: [https://pubchem.ncbi.nlm.nih.gov/compound/IGF-1-DES](https://pubchem.ncbi.nlm.nih.gov/compound/IGF-1-DES).